2021-07-17_00000178_2_19 Domain 5 Parse 1 Confidence: 0.92

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
96495CompleteStructure predictionRoseTTAFold2021-07-17_00000178_2_19120617 Jul 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
91543510.92comparative modeling1104-120610318 Jul 2021
              . 1110    . 1120    . 1130    . 1140    . 1150    . 1160    . 1170    . 1180    . 1190    . 1200    . 
   sequence: AGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT
 deepconcnf: -EE------HHHHHHHHHHHH--HHHHHHHHH---------HHHHHHHH--HHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHH-----HHHHHHHH--
    psipred: ---------HHHHHHHHHHHH--HHHHHHHHHH--------HHHHHHHH--HHHHHHHHHHH--------HHHHHHHHHHHHHHHHHH-----HHHHHHHHH-
    spider3: EEEE-----HHHHHHHHHHH---HHHHHHHHHH--------HHHHHHHH--HHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHH-----HHHHHHHH--
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington