User input for job 698874

Modeling method RoseTTAFold only

Sequence

FNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNSNGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVFQQIDANWNIQCWLKGDLKLFICYVESLFKNLFRNYNYKVHLLYVLPEVLEDSPLVPQKGSFQMVHCNCSVHECCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMV

Constraints

AtomPair CB 16 CB 69 BOUNDED 0.000 0.000 1.000 # AtomPair CB 68 CB 78 BOUNDED 0.000 0.000 1.000 # AtomPair CB 110 CB 121 BOUNDED 0.000 0.000 1.000 # AtomPair CB 165 CB 175 BOUNDED 0.000 0.000 1.000 # AtomPair CB 167 CB 172 BOUNDED 0.000 0.000 1.000 #

Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington