SSGCID - BrmaA.20617.a Uncharacterized protein target class GPCR RoseTTAFold

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
106668CompleteStructure prediction ssgcidSSGCID - BrmaA.20617.a Un...1393 Aug 2021-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .    
   sequence: MEVICVVVAIYNGLSDSVWSISSTLINLATIILYAILSRVMVKAKTSTKNFELLQTLKIVVAFIGLGQLASTIIYLSTMFFDFSEMTAFYIGSIIMKSVFCSTEYRNEFKKQLRKFPCLKNTVKLTPKSTIRRVTTIHR
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
99716110.66RoseTTAFold1-1391394 Aug 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington