SSGCID - BewuA.20421.a ORF10 TrRosetta
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 15726 | Complete | Structure prediction | ssgcid | SSGCID - BewuA.20421.a OR... | 38 | 8 Feb 2020 | - |
1 . 10 . 20 . 30 .
sequence: MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
disopred: D-------------------------------------
tmhmm: --------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 15584 | 1 | 1 | 0.00 | TrRosetta | 1-38 | 38 | 9 Feb 2020 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington