2021-12-04_00000036_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
158352CompleteStructure predictionRoseTTAFold2021-12-04_00000036_1_191674 Dec 2021-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  
   sequence: MGQSEKQEEPDYPINKFMNTTDEIWVFRTTQENVQKCKKDKNKYMTTSATFFTRSHEEQDQIHEQELVGKFANFYDKPDGVYDRIDITGDKTGVYEEALAYASKENTCGVVGVWAFDGETTVVWRELRVRNRPNDATKVDEMCKKKFDDYVQVVNKSWTSPYNEKCK
   disopred: DDDDD------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
154487110.74RoseTTAFold1-1671674 Dec 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington