2021-12-18_00000089_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 164095 | Complete | Structure prediction | RoseTTAFold | 2021-12-18_00000089_1_19 | 63 | 18 Dec 2021 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: GRRVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
disopred: DDDDD--D-------------------------------------------------------
tmhmm: ---------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 160178 | 1 | 1 | 0.87 | RoseTTAFold | 1-63 | 63 | 18 Dec 2021 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington