2022-01-29_00000208_1_19
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
200277 | Complete | Structure prediction | RoseTTAFold | 2022-01-29_00000208_1_19 | 34 | 29 Jan 2022 | - |
1 . 10 . 20 . 30
sequence: GDCLGWFSGCDPNNNKCCEGYVCHWKYPWCRYDL
disopred: D---------------------------------
tmhmm: ----------------------------------
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
196464 | 1 | 1 | 0.82 | RoseTTAFold | 1-34 | 34 | 29 Jan 2022 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington