2022-02-12_00000023_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 209168 | Complete | Structure prediction | RoseTTAFold | 2022-02-12_00000023_1_19 | 44 | 12 Feb 2022 | - |
1 . 10 . 20 . 30 . 40
sequence: MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEP
disopred: D-----------------------------------------DD
tmhmm: --------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 205110 | 1 | 1 | 0.91 | RoseTTAFold | 1-44 | 44 | 12 Feb 2022 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington