2022-03-05_00000053_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 232210 | Complete | Structure prediction | RoseTTAFold | 2022-03-05_00000053_1_19 | 55 | 5 Mar 2022 | - |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: MNVNKKKLAEIFGCDVRTVTAWQSQGLPLVSGGGKGNEAVFDTAAAISWYAERDA
disopred: -----------------------------------------------------DD
tmhmm: -------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 228103 | 1 | 1 | 0.90 | RoseTTAFold | 1-55 | 55 | 5 Mar 2022 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington