2022-03-05_00000068_2_11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 232211 | Complete | Structure prediction | cameo | 2022-03-05_00000068_2_11 | 60 | 5 Mar 2022 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: SEFLANMSHEIRTPLNGILGFTNLLQKSELSPRQQDYLTTIQKSAESLLGIINEILDFSK
disopred: ------------------------------------------------------------
tmhmm: ------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 228099 | 1 | 1 | 0.85 | TrRefineRosetta | 1-60 | 60 | 5 Mar 2022 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington