SSGCID - LpboA.19148.a Glycosyltransferase

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
2687CompleteStructure predictionssgcidSSGCID - LpboA.19148.a Gl...2209 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
   sequence: MKKAPTVSVIVAAFNQEKYIGRCIRSLLNQNFPKEDYEIIIINDGSTDKTKYALEIFGKEIKVIENESNKGLSASLNLGIRSALGQFIVRVDADDYVNSDYVSILHKFLSYNPNFDAVACDYYLVDDHEDFLSRKNCMIDPIGCGIMFRIEQLIDIGLYDDGFLSHEDKDLRIRFEKKYSIHRVELPLYRYRRHDSNMTNDSELMDERMKSLREKHKDQP
 deepconcnf: -----EEEEEEE------HHHHHHHHHHH-------EEEEEEE-----HHHHHHHH----EEEEE------HHHHHHHHHHH----EEEEEE------HHHHHHHHHHHHH-----EEEEEEEEE-----EEEEEE-------EEEEEEHHHHHH----------HHHHHHHHHHHHH--EEEE-HHHHHHH---------HHHHHHHHHHHHHH-----
    psipred: ------EEEEE-----HHHHHHHHHHHHH-------EEEEEEE----HHHHHHHHH----EEEEE------HHHHHHHHHHHH---EEEEE-HHH---HHHHHHHHHHHHH---EEEEE--EEEE-----EEEEEE---------EEEEHHHHHHH------------HHHHHHHHHH--EEE--HHH-EEEE------HHHHHHHHHHHHHHHH-----
    spider3: -----EEEEEEE---HHHHHHHHHHHHHH-------EEEEEEE------HHHHHHHH---EEEEE------HHHHHHHHHHH----EEEEEE-H----HHHHHHHHHHHHH-----EEEEEEEEE-----EEEEE----------EEEEHHHHHH----------HHHHHHHHHHHHH--EEE----EEEEE-------HHHHHHHHHHHHHHHHH----
   disopred: DDD----D---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDD--------------DDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
2895110.82comparative modeling1-22022012 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington