2022-05-07_00000054_2_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 299566 | Complete | Structure prediction | RoseTTAFold | 2022-05-07_00000054_2_19 | 55 | 7 May 2022 | - |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: SVIEKLRKLEKQARKQGDEVLVMLARMVLEYLEKGWVSEEDADESADRIEEVLKK
disopred: DDDD-DDDDDDDDDDDDDDD-----------------DDDDDDDDDDD-----DD
tmhmm: -------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 295389 | 1 | 1 | 0.81 | RoseTTAFold | 1-55 | 55 | 7 May 2022 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington