T1064

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
30186CompleteStructure predictioncaspT106410622 Jun 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    . 
   sequence: FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
    psipred: ---HHHHHHHH-------------------EEEE------HHHHHHHHHH-----EEEHHH--EEEEEEEEEEE--------EEEEEEEE-----EEEEEEEEEE-
    spider3: -----EHHHHH-------------------EEEE-------EEEEEE-----EEEEEEEE---EEEEEE-EEEE--------EEEEEEEEE----EEEEEEEE---
 deepconcnf: -----EEE---------------------EEEEE-----HHHHHH----------EEEEE---EEEEEEEEEEE-------EEEEEEEEE--------EEEEEEE-
   disopred: DDD--DDD--------------------------------------------------------------------------------------------------
      tmhmm: ----------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
29585110.00comparative modeling1-10610622 Jun 2020
29586120.26ab initio1-10610622 Jun 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington