2022-07-16_00000216_2_11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 370711 | Error | Structure prediction | cameo | 2022-07-16_00000216_2_11 | 73 | 16 Jul 2022 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: DDPVKVRKWKHVQMEKIRRINTKEAFERLIKSVRTPPKENGKRIPKHILLTCVMNDIKSIRSANEALQHILDD
disopred: DDD----DD-------------------------DDDDDDDDDDDDDD-----------------DDDDDDDD
tmhmm: -------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 367056 | 1 | 1 | n/a | TrRefineRosetta | 1-73 | 73 | 16 Jul 2022 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington