2022-07-16_00000216_2_19
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
370712 | Complete | Structure prediction | RoseTTAFold | 2022-07-16_00000216_2_19 | 73 | 16 Jul 2022 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: DDPVKVRKWKHVQMEKIRRINTKEAFERLIKSVRTPPKENGKRIPKHILLTCVMNDIKSIRSANEALQHILDD
disopred: DDD----DD-------------------------DDDDDDDDDDDDDD-----------------DDDDDDDD
tmhmm: -------------------------------------------------------------------------
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
367057 | 1 | 1 | 0.84 | RoseTTAFold | 1-73 | 73 | 16 Jul 2022 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington