2022-09-24_00000025_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 419441 | Error | Structure prediction | RoseTTAFold | 2022-09-24_00000025_1_19 | 50 | 24 Sep 2022 | - |
1 . 10 . 20 . 30 . 40 . 50
sequence: DFDPTEFKGPFPTIEICSKYCAVVCNYTSRPCYCVEAAKERDQWFPYCYD
disopred: DDD-----------------------------------------------
tmhmm: --------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 414976 | 1 | 1 | n/a | RoseTTAFold | 1-50 | 50 | 27 Sep 2022 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington