2022-09-24_00000087_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
419446ErrorStructure predictioncameo2022-09-24_00000087_1_1127524 Sep 2022-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
   sequence: GPMVVNQKISGLASAMNAKIIGSGERSMVLAHGFGGDQSVWDKIIPVLSQSFKVLVFDWLFSGAIKDQTLYDPSKYNSLDVFSDDLIALMEELKFGPVVFVGHSMSGVIGCAASIKRPDLFTNLLLIAASPRYINSEDYKGGFESKDIDTIITSIGSNYEAWAVDFSSFVVDSRDSLSVQRFEKSLKKMKPETALALAKIVFGSDEREILGQVSVPCHVIQPGNDVVVPVSVAYFMQEKIKGKSTVEIIEDAIGHFPQMTSHLELLGVMRRLLEF
   disopred: DDDDD-D----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
41498811n/aTrRefineRosetta1-27527527 Sep 2022



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington