2023-03-18_00000082_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 498704 | Complete | Structure prediction | RoseTTAFold | 2023-03-18_00000082_1_19 | 81 | 18 Mar 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80
sequence: SLDCMGDKSGKGGRLFVAVFDYETPDREGIIGFKAGDRFLIEEYAENGWCEAIHMDTAERPVQKGLVPGNFLRPLEGETKL
disopred: DDDDDDDDDDDDDDDDD-----------------------------------------------------------DDDDD
tmhmm: ---------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 493402 | 1 | 1 | 0.73 | RoseTTAFold | 1-81 | 81 | 18 Mar 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington