2023-03-25_00000186_2_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 500217 | Complete | Structure prediction | RoseTTAFold | 2023-03-25_00000186_2_19 | 35 | 25 Mar 2023 | - |
1 . 10 . 20 . 30 .
sequence: SLVESVEFRVDHPFIFFIRNTQTKDILFVGQVNHL
disopred: DD---------------------------------
tmhmm: -----------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 495062 | 1 | 1 | 0.84 | RoseTTAFold | 1-35 | 35 | 25 Mar 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington