2023-03-25_00000252_2_19
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
500233 | Complete | Structure prediction | RoseTTAFold | 2023-03-25_00000252_2_19 | 32 | 25 Mar 2023 | - |
1 . 10 . 20 . 30
sequence: GCRGLKRLYEAFCKQDSDCLAGCVCPMFSECG
disopred: DDDD---------------------------D
tmhmm: --------------------------------
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
495074 | 1 | 1 | 0.71 | RoseTTAFold | 1-32 | 32 | 25 Mar 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington