2023-04-08_00000022_2_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 504799 | Complete | Structure prediction | RoseTTAFold | 2023-04-08_00000022_2_19 | 42 | 8 Apr 2023 | - |
1 . 10 . 20 . 30 . 40
sequence: QNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
disopred: DDD-------------------------DDDDDDDDDDDDDD
tmhmm: ------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 499705 | 1 | 1 | 0.92 | RoseTTAFold | 1-42 | 42 | 8 Apr 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington