2023-05-06_00000185_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 514428 | Complete | Structure prediction | RoseTTAFold | 2023-05-06_00000185_1_19 | 67 | 6 May 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: PDEDLKAELAATEAIWLLRQGRPEEVWKLMQRLYEKGDPALWAVLRALLRSGDEIAILIAWNFMQRI
disopred: DDDD---------------------------------------------------------------
tmhmm: -------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 509615 | 1 | 1 | 0.81 | RoseTTAFold | 1-67 | 67 | 6 May 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington