2023-05-13_00000050_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 517210 | Complete | Structure prediction | RoseTTAFold | 2023-05-13_00000050_1_19 | 45 | 13 May 2023 | - |
1 . 10 . 20 . 30 . 40 .
sequence: GPGSRDVEMEEMIEQLQEKVHELERQNEVLKNRLISAKQQLQVQG
disopred: DDDDD--DD---------DDDDDDDDDDDDDDD----D---DDDD
tmhmm: ---------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 512156 | 1 | 1 | 0.95 | RoseTTAFold | 1-45 | 45 | 13 May 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington