2023-05-13_00000092_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 517236 | Complete | Structure prediction | RoseTTAFold | 2023-05-13_00000092_1_19 | 104 | 13 May 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
sequence: GAMLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELA
disopred: ----------------------------------------------DDDDDDDDDDDDDDDDDDDDD------------------------------------D
tmhmm: --------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 512186 | 1 | 1 | 0.85 | RoseTTAFold | 1-104 | 104 | 13 May 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington