2023-05-27_00000100_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 522229 | Complete | Structure prediction | RoseTTAFold | 2023-05-27_00000100_1_19 | 41 | 27 May 2023 | - |
1 . 10 . 20 . 30 . 40
sequence: ASCPNVGAVCSPFETKPCGNVKDCRCLPWGLFFGTCINPTG
disopred: DDDDDDDDD-----------------------------DDD
tmhmm: -----------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 521962 | 1 | 1 | 0.87 | RoseTTAFold | 1-41 | 41 | 5 Jun 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington