2023-07-08_00000072_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 535012 | Complete | Structure prediction | RoseTTAFold | 2023-07-08_00000072_1_19 | 137 | 10 Jul 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 .
sequence: MNFKIKAKGHKNVLSLHKSTFEITKDKDLSLSGDCIIGLDIDKCMLDFPKEFKEKLANDETIVTVKLKSPNAYDEIVGYGHHDLTLDHPTDIVCRKSDFICSRTLMIKSDKAAIDLNRDLIEDLANGESLDVEIILS
disopred: -----------------------------------------------------------------------------------------------------------------------------------------
tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 529861 | 1 | 1 | 0.92 | RoseTTAFold | 1-137 | 137 | 10 Jul 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington