2023-07-29_00000067_2_11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 538809 | Error | Structure prediction | cameo | 2023-07-29_00000067_2_11 | 67 | 29 Jul 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: AVSVAAQKLRLALDMYEVGEQMQRMRLGRERPNADVVEIEAAIDAWRMTRPGAEEGDSAGPTSTRFT
disopred: DDDDDD-DD----------------DDDDDDDDDDD------------------------DDDDDDD
tmhmm: -------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 533663 | 1 | 1 | n/a | TrRefineRosetta | 1-67 | 67 | 29 Jul 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington