2023-10-21_00000000_1_11
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
557516 | Error | Structure prediction | cameo | 2023-10-21_00000000_1_11 | 72 | 21 Oct 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: AMRKDAKAPYVTVFDERDGCGGPTKAGGNSGDNKGLCVKVAMKKVAYGEGGVDRIGEMARDVFVNYDKQRGK
disopred: DDDDD--DD----------DDDDDDDDDDDDDDDD--------------------------DDDDDDDDDDD
tmhmm: ------------------------------------------------------------------------
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
552255 | 1 | 1 | n/a | TrRefineRosetta | 1-72 | 72 | 21 Oct 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington