2023-11-25_00000178_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 568122 | Complete | Structure prediction | RoseTTAFold | 2023-11-25_00000178_1_19 | 77 | 25 Nov 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: SMQVFIKNRYGWTITLEVSPTDTVENVKQKIQDKEGFPPDKIRLIYGGKQMEDGRTLADYNVQKDSTILICIRDVDC
disopred: -----------------------------------------------------------------------------
tmhmm: -----------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 562789 | 1 | 1 | 0.92 | RoseTTAFold | 1-77 | 77 | 25 Nov 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington