2023-12-02_00000079_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 571049 | Complete | Structure prediction | RoseTTAFold | 2023-12-02_00000079_1_19 | 73 | 2 Dec 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: GHMKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVK
disopred: D-----------------------------------------------------------------------D
tmhmm: -------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 565619 | 1 | 1 | 0.67 | RoseTTAFold | 1-73 | 73 | 2 Dec 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington