2023-12-09_00000180_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 573548 | Complete | Structure prediction | RoseTTAFold | 2023-12-09_00000180_1_19 | 89 | 9 Dec 2023 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: QVYDKVVLRGESPLRWDGENHPLTFDESEGLWKSEPVTLSGGIQFEYKFVMDNEWLAGDNLRFQVPQTGDYVFYFDPSDQRKVDVRPVT
disopred: D----------------------------------------------------------------------------------------
tmhmm: -----------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 568015 | 1 | 1 | 0.88 | RoseTTAFold | 1-89 | 89 | 9 Dec 2023 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington