2024-02-17_00000205_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 594413 | Complete | Structure prediction | RoseTTAFold | 2024-02-17_00000205_1_19 | 148 | 17 Feb 2024 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 .
sequence: GPDSPWEGSLDMFSIKHFRAKAQLISGHSCQLVQALPDVIRSAGRLPPSHVWDLLDSMGPSKAKDICVIRLCPHGSRDIQNYRLLYSYLNNKQCHCLATVQQVKMVLLPLPAFEPLPARLRPLGGPGLEITHTSLLLAVLFPKDALPD
disopred: -------------------------------------------------------------------------------------------------------------------------------------------------DDD
tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 588643 | 1 | 1 | 0.83 | RoseTTAFold | 1-148 | 148 | 17 Feb 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington