2024-03-09_00000136_1_11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 601192 | Error | Structure prediction | cameo | 2024-03-09_00000136_1_11 | 31 | 11 Mar 2024 | - |
1 . 10 . 20 . 30
sequence: DEPGSSVVTCTKDSMTVRIPRTLSGFDDEIP
disopred: DDDD---D------------------DDDDD
tmhmm: -------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 595420 | 1 | 1 | n/a | TrRefineRosetta | 1-31 | 31 | 11 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington