def2
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 602889 | Expired | Structure prediction | nilashis | def2 | 38 | 15 Mar 2024 | 29 Apr 2024 |
1 . 10 . 20 . 30 .
sequence: SYYSTLQARNNHGHARRLAFHGEQWIGNANGRHQHAAK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 597116 | 1 | 1 | 0.60 | RoseTTAFold | 1-38 | 38 | 15 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington