Q856R8
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
603292 | Expired | Structure prediction | limeizhang2021 | Q856R8 | 102 | 17 Mar 2024 | 2 May 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
sequence: MFYAACVPATNEWHGAACAARRDLPWTADTMPSAAQRRRMSAVCAECPVLTRCAMHALKGVTGGFYAGVWIPWKGTAAATAETRRSIRASLRRVVTSPAPTR
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
597543 | 1 | 1 | 0.65 | RoseTTAFold | 1-102 | 102 | 17 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington