GA88_A
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 603300 | Expired | Structure prediction | blonnquist | GA88_A | 56 | 17 Mar 2024 | 2 May 2024 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 597560 | 1 | 1 | 0.87 | RoseTTAFold | 1-56 | 56 | 17 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington