5O0U
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 603411 | Expired | Structure prediction | liaoyang | 5O0U | 30 | 18 Mar 2024 | 3 May 2024 |
1 . 10 . 20 . 30
sequence: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 597671 | 1 | 1 | 0.76 | RoseTTAFold | 1-30 | 30 | 18 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington