Hbx Consensus sequence Xsubstituted
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
605377 | Complete | Structure prediction | kuldeep4 | Hbx Consensus sequence Xs... | 150 | 22 Mar 2024 | 6 May 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150
sequence: MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
599619 | 1 | 1 | 0.49 | RoseTTAFold | 1-150 | 150 | 22 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington