Hbx Consensus sequence Xsubstituted

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
605379CompleteStructure prediction kuldeep4Hbx Consensus sequence Xs...15022 Mar 20246 May 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
   sequence: MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
599621110.42RoseTTAFold1-15015022 Mar 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington