2024-03-23_00000017_1_19
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 606140 | Complete | Structure prediction | RoseTTAFold | 2024-03-23_00000017_1_19 | 72 | 23 Mar 2024 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: SEFGEKQRVFTGIVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQP
disopred: DDDDDDDDDDDDD---------------------------------------------------D----DDD
tmhmm: ------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 600387 | 1 | 1 | 0.87 | RoseTTAFold | 1-72 | 72 | 23 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington