2024-03-23_00000292_2_11
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 606170 | Error | Structure prediction | cameo | 2024-03-23_00000292_2_11 | 94 | 23 Mar 2024 | - |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: KLRPLHDRVVVKRIEAERKTASGIVIPDTAGEKPDQGEVLAVGDGKILDDGSKRPMAVKVGDKVLFGKYAGQTVKVEGEELLVLREDDIMAVIE
disopred: ----------------------------------------------------------------------------------------------
tmhmm: ----------------------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 600653 | 1 | 1 | n/a | TrRefineRosetta | 1-94 | 94 | 23 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington