PDZ
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 606406 | Complete | Structure prediction | jackB123456 | PDZ | 91 | 23 Mar 2024 | 7 May 2024 (33:46:08) |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: SGRTRRKITIKKSEHSSGTYGFSLVAKDEDGTRILVVKSVDENGLAAKYGLKEGDLILEVNDVPVAELDDESIKKAFSQPSVSLLIERTPE
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 600639 | 1 | 1 | 0.90 | RoseTTAFold | 1-91 | 91 | 23 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington