D3
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
607785 | Complete | Structure prediction | Nothing789 | D3 | 98 | 27 Mar 2024 | 12 May 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 .
sequence: EYDLEVYGLESEYIIGDSATQLDLTLEATGDIKTEMTVYNHHHESLSSHSAELSDGQVEAATMTLSKSEPGHHMLVVVVKDQQGKVIEQNTLDFHLIE
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
602051 | 1 | 1 | 0.90 | RoseTTAFold | 1-98 | 98 | 27 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington