def3
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 608805 | Complete | Structure prediction | nilashis | def3 | 41 | 28 Mar 2024 | 12 May 2024 (59:45:08) |
1 . 10 . 20 . 30 . 40
sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 603065 | 1 | 1 | 0.90 | RoseTTAFold | 1-41 | 41 | 28 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington