CS8
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 610057 | Complete | Structure prediction | ravenkok | CS8 | 84 | 31 Mar 2024 | 15 May 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80
sequence: MKFLVFLGIITTVAAVNFNFNGLVNFNFNGLVNFNFNGLVNFNFNGLVNFNFNGLGSGYIPEAPRDGHAYVRKDGEWVLLSTFL
disopred: ------------------------------------------------------------------------------------
tmhmm: ---TTTTTTTTTTTTTTTTTTTTTTT----------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 604329 | 1 | 1 | 0.21 | comparative modeling | 1-84 | 84 | 31 Mar 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington