Protein
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 610101 | Complete | Structure prediction | kesariwarna | Protein | 59 | 1 Apr 2024 | 16 May 2024 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 604363 | 1 | 1 | 0.90 | RoseTTAFold | 1-59 | 59 | 1 Apr 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington