Thioredoxin 2
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
610443 | Expired | Structure prediction | efroehlich | Thioredoxin 2 | 149 | 1 Apr 2024 | 16 May 2024 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 .
sequence: GSHMMIIVCASCDAKNRVPEEKLTAQPSCGQCHQPLLPLEPIELNEQNFSNYITNSDLPILIDLWAEWCGPCKMMAPHFAQVAKQNPRVIFAKINTEESPRLSQAFNVRSIPTLVLMNKTTEVARMSGALRAPELQQWLDQQLQTNFGS
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
604707 | 1 | 1 | 0.90 | RoseTTAFold | 1-149 | 149 | 1 Apr 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington