Thioredoxin 2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
610443ExpiredStructure prediction efroehlichThioredoxin 21491 Apr 202416 May 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .    
   sequence: GSHMMIIVCASCDAKNRVPEEKLTAQPSCGQCHQPLLPLEPIELNEQNFSNYITNSDLPILIDLWAEWCGPCKMMAPHFAQVAKQNPRVIFAKINTEESPRLSQAFNVRSIPTLVLMNKTTEVARMSGALRAPELQQWLDQQLQTNFGS
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
604707110.90RoseTTAFold1-1491491 Apr 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington