FAM20A affected Robetta modelling

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
610742CompleteStructure prediction SADAQAT ULLAHFAM20A affected Robetta m...783 Apr 202420 May 2024
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   
   sequence: MPGLRRDRLLTLLLLGALLSADLYFHLWPQVQRQLRPRERPRGCPCTGRASSLARDSAAAASEPRHDRAQLFPNRAPD
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
605004110.74RoseTTAFold1-78783 Apr 2024



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington