FAM20A affected Robetta modelling
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 610742 | Complete | Structure prediction | SADAQAT ULLAH | FAM20A affected Robetta m... | 78 | 3 Apr 2024 | 20 May 2024 (01:28:12) |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: MPGLRRDRLLTLLLLGALLSADLYFHLWPQVQRQLRPRERPRGCPCTGRASSLARDSAAAASEPRHDRAQLFPNRAPD
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 605004 | 1 | 1 | 0.74 | RoseTTAFold | 1-78 | 78 | 3 Apr 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington