modLL-37
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 611295 | Complete | Structure prediction | taliaritchie | modLL-37 | 37 | 6 Apr 2024 | 21 May 2024 |
1 . 10 . 20 . 30 .
sequence: RLGDFFRESKEKIGKEFKRIVQRIKDFLRNLVPRTES
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 605532 | 1 | 1 | 0.92 | RoseTTAFold | 1-37 | 37 | 6 Apr 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington