HPV40_Protein_E5
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 613143 | Complete | Structure prediction | Sanjanagupte | HPV40_Protein_E5 | 43 | 17 Apr 2024 | 1 Jun 2024 |
1 . 10 . 20 . 30 . 40
sequence: MLTCQLDDGDTWMALWMLLAFITVLLLLLVFHCRTLYLYSYTK
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 607338 | 1 | 1 | 0.79 | RoseTTAFold | 1-43 | 43 | 17 Apr 2024 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington